| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRPL19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRPL19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPL19. This antibody reacts with human. The MRPL19 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MRPL19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAAIWKE |
|---|
| Other Names | KIAA0104L19mt, L15mt, MGC20675, mitochondrial, mitochondrial ribosomal protein L19, MRPL1539S ribosomal protein L19, mitochondrial, MRP-L15MRP-L19, RLX1, RPML15 |
|---|
| Gene, Accession # | MRPL19, Gene ID: 9801, Accession: P49406, SwissProt: P49406 |
|---|
| Catalog # | NBP2-33795 |
|---|
| Price | |
|---|
| Order / More Info | MRPL19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|