| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRPL22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRPL22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPL22. This antibody reacts with human. The MRPL22 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRPL22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IKEVLLQAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL |
|---|
| Other Names | 39S ribosomal protein L25, mitochondrial, DKFZp781F1071, L22mt, L25mt, mitochondrial ribosomal protein L22, MRP-L22, MRPL25, MRP-L25HSPC158, RPML2539S ribosomal protein L22, mitochondrial |
|---|
| Gene, Accession # | MRPL22, Gene ID: 29093, Accession: Q9NWU5, SwissProt: Q9NWU5 |
|---|
| Catalog # | NBP2-30482 |
|---|
| Price | |
|---|
| Order / More Info | MRPL22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|