| Edit |   |
|---|
| Antigenic Specificity | Secretagogin, EF-Hand Calcium Binding Protein (SCGN) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. |
|---|
| Immunogen | SCGN antibody was raised using the middle region of SCGN corresponding to a region with amino acids KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP |
|---|
| Other Names | SCGN|MGC146683|CALBL|DJ501N12.8|SECRET|SEGN|setagin|zgc:100843 |
|---|
| Gene, Accession # | Gene ID: 10590,214189,306942 |
|---|
| Catalog # | ABIN631460 |
|---|
| Price | |
|---|
| Order / More Info | Secretagogin, EF-Hand Calcium Binding Protein (SCGN) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|