| Edit |   |
|---|
| Antigenic Specificity | SorCS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SorCS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SorCS2. This antibody reacts with human. The SorCS2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SorCS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYG |
|---|
| Other Names | KIAA1329VPS10 domain receptor protein, sortilin-related VPS10 domain containing receptor 2, VPS10 domain-containing receptor SorCS2 |
|---|
| Gene, Accession # | SORCS2, Gene ID: 57537 |
|---|
| Catalog # | NBP2-56711 |
|---|
| Price | |
|---|
| Order / More Info | SorCS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|