| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EPB41L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EPB41L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EPB41L1. This antibody reacts with human. The EPB41L1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EPB41L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAK |
|---|
| Other Names | band 4.1-like protein 1, DKFZp686H17242, erythrocyte membrane protein band 4.1-like 1, KIAA0338Neuronal protein 4.1,4.1N, MGC11072, neuron-type nonerythroid protein 4.1 |
|---|
| Gene, Accession # | EPB41L1, Gene ID: 2036, Accession: Q9H4G0, SwissProt: Q9H4G0 |
|---|
| Catalog # | NBP2-31650 |
|---|
| Price | |
|---|
| Order / More Info | EPB41L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|