| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFC2. This antibody reacts with human. The NDUFC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NDUFC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDK |
|---|
| Other Names | B14.5b, CI-B14.5b, complex I subunit B14.5b, Complex I-B14.5b, HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b), Human lung cancer oncogene 1 protein, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa, NADH dehydrogenase [ubiquinone] 1 subunit C2, NADHDH2, NADH-ubiquinone oxidoreductase subunit B14.5b |
|---|
| Gene, Accession # | NDUFC2, Gene ID: 4718, Accession: O95298 |
|---|
| Catalog # | NBP2-46831 |
|---|
| Price | |
|---|
| Order / More Info | NDUFC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|