| Edit |   |
| Antigenic Specificity | FAM174B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 86%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human FAM174B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SGKRLKKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR |
| Other Names | family with sequence similarity 174, member B, LOC400451, MGC102891 |
| Gene, Accession # | Gene ID: 400451, UniProt: Q3ZCQ3, ENSG00000185442 |
| Catalog # | HPA015306 |
| Price | |
| Order / More Info | FAM174B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |