| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ROR alpha/NR1F1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ROR alpha/NR1F1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ROR alpha/NR1F1. This antibody reacts with human. The ROR alpha/NR1F1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human RORA (NP_599022). Peptide sequence GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP. |
|---|
| Other Names | DKFZp686M2414, MGC119326, NR1F1MGC119329, nuclear receptor ROR-alpha, Nuclear receptor RZR-alpha, Nuclear receptor subfamily 1 group F member 1, RAR-related orphan receptor A, RAR-related orphan receptor alpha, retinoic acid receptor-related orphan receptor alpha, retinoid-related orphan receptor alpha, Retinoid-related orphan receptor-alpha, ROR1, ROR2, ROR3, RZR-ALPHA, RZRAROR-alpha, transcription factor RZR-alpha |
|---|
| Gene, Accession # | RORA, Gene ID: 6095, Accession: P35398, SwissProt: P35398 |
|---|
| Catalog # | NBP1-52828 |
|---|
| Price | |
|---|
| Order / More Info | ROR alpha/NR1F1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|