| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTS10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTS10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS10. This antibody reacts with human. The ADAMTS10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADAMTS10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK |
|---|
| Other Names | a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 10, ADAM metallopeptidase with thrombospondin type 1 motif, 10, ADAM-TS 10, ADAMTS-10, ADAM-TS10A disintegrin and metalloproteinase with thrombospondin motifs 10, EC 3.4.24.-, EC 3.4.24.82, WMS, zinc metalloendopeptidase |
|---|
| Gene, Accession # | ADAMTS10, Gene ID: 81794, Accession: Q9H324, SwissProt: Q9H324 |
|---|
| Catalog # | NBP1-89248 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTS10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|