| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTS12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTS12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS12. This antibody reacts with human. The ADAMTS12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETK |
|---|
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 12, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 12, ADAM metallopeptidase with thrombospondin type 1 motif, 12, ADAM-TS 12, ADAM-TS12, ADAMTS-12, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.82, PRO4389 |
|---|
| Gene, Accession # | ADAMTS12, Gene ID: 81792 |
|---|
| Catalog # | NBP2-68996 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTS12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|