| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTS4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTS4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS4. This antibody reacts with human. The ADAMTS4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ADAMTS4(ADAM metallopeptidase with thrombospondin type 1 motif, 4) The peptide sequence was selected from the N terminal of ADAMTS4 (AAH30812). Peptide sequence GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL. |
|---|
| Other Names | a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4 |
|---|
| Gene, Accession # | ADAMTS4, Gene ID: 9507, Accession: O75173, SwissProt: O75173 |
|---|
| Catalog # | NBP1-54369 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTS4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|