| 产品详情 |
| Edit |   |
| Antigenic Specificity | ADAMTS5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADAMTS5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS5. This antibody reacts with human. The ADAMTS5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ADAMTS5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQ |
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 11, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 5 (aggrecanase-2), ADAM metallopeptidase with thrombospondin type 1 motif, 5, ADAM-TS 11, ADAM-TS 5, ADAMTS-11, ADAM-TS5, ADAMTS-5, ADMP2, ADMP-2A disintegrin and metalloproteinase with thrombospondin motifs 5, Aggrecanase-2, disintegrin-like and metalloprotease with thrombospondin type 1 motif, 510ADAMTS11FLJ36738, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, EC 3.4.24.82 |
| Gene, Accession # | ADAMTS5, Gene ID: 11096 |
| Catalog # | NBP2-55654 |
| Price | |
| Order / More Info | ADAMTS5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|