| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAMTS7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAMTS7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS7. This antibody reacts with human. The ADAMTS7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ADAMTS7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN |
|---|
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 7, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 7, ADAM metallopeptidase with thrombospondin type 1 motif, 7, ADAM-TS 7, ADAMTS-7, ADAM-TS7a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein, COMPase, DKFZp434H204, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.82 |
|---|
| Gene, Accession # | ADAMTS7, Gene ID: 11173, Accession: Q9UKP4, SwissProt: Q9UKP4 |
|---|
| Catalog # | NBP2-38539 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTS7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|