| Edit |   |
|---|
| Antigenic Specificity | DDHD Domain Containing 2 (DDHD2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures. |
|---|
| Immunogen | DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD |
|---|
| Other Names | SAMWD1|SPG54|2010305K11Rik|mKIAA0725 |
|---|
| Gene, Accession # | Gene ID: 23259 |
|---|
| Catalog # | ABIN632655 |
|---|
| Price | |
|---|
| Order / More Info | DDHD Domain Containing 2 (DDHD2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|