| Edit |   |
|---|
| Antigenic Specificity | Transmembrane Protein 48 (TMEM48) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane. |
|---|
| Immunogen | TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD |
|---|
| Other Names | tmem48|wu:fk93f04|zgc:55636|NET3|TMEM48|2810475A17Rik|AI450313|Tmem48 |
|---|
| Gene, Accession # | Gene ID: 55706 |
|---|
| Catalog # | ABIN635787 |
|---|
| Price | |
|---|
| Order / More Info | Transmembrane Protein 48 (TMEM48) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|