| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CLCN5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CLCN5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLCN5. This antibody reacts with human. The CLCN5 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CLCN5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVG |
|---|
| Other Names | chloride channel 5, Chloride channel protein 5, Chloride transporter ClC-5, clC-5, CLC5, CLCK2NPHL2, DENTSNPHL1, H(+)/Cl(-) exchange transporter 5, hCIC-K2, hClC-K2, nephrolithiasis 1 (X-linked), nephrolithiasis 2, X-linked, XLRH, XRN |
|---|
| Gene, Accession # | CLCN5, Gene ID: 1184 |
|---|
| Catalog # | NBP2-58621 |
|---|
| Price | |
|---|
| Order / More Info | CLCN5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|