| Edit |   |
|---|
| Antigenic Specificity | Protein Phosphatase 1J (PPM1J) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known. |
|---|
| Immunogen | PPM1 J antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE |
|---|
| Other Names | 2310008J22Rik|PP2Czeta|Ppp2cz|PP2CZ|PPP2CZ |
|---|
| Gene, Accession # | Gene ID: 333926,71887 |
|---|
| Catalog # | ABIN632095 |
|---|
| Price | |
|---|
| Order / More Info | Protein Phosphatase 1J (PPM1J) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|