| Edit |   |
|---|
| Antigenic Specificity | LAS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LAS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LAS2. This antibody reacts with human. The LAS2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human C18orf54The immunogen for this antibody is C18ORF54. Peptide sequence PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN. |
|---|
| Other Names | C18orf54, chromosome 18 open reading frame 54, hypothetical protein LOC162681, LAS2, MGC33382 |
|---|
| Gene, Accession # | C18ORF54, Gene ID: 162681, Accession: EAW63006.1, SwissProt: EAW63006.1 |
|---|
| Catalog # | NBP1-79525-20ul |
|---|
| Price | |
|---|
| Order / More Info | LAS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|