| Edit |   |
|---|
| Antigenic Specificity | Microsomal Triglyceride Transfer Protein (MTTP) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. |
|---|
| Immunogen | MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK |
|---|
| Other Names | CG9342|CT3751|Dmel\\CG9342|MTP|dMTP|wu:fd36b01|zgc:111876|1810043K16Rik|ABL|MTTP|Dusg|Fpn1|IREG1|MTP1|Ol5|Pcm|Slc11a3|Slc39a1 |
|---|
| Gene, Accession # | Gene ID: 4571,17777,310900 |
|---|
| Catalog # | ABIN635912 |
|---|
| Price | |
|---|
| Order / More Info | Microsomal Triglyceride Transfer Protein (MTTP) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|