| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTP pi/PTPRU |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTP pi/PTPRU Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTP pi/PTPRU. This antibody reacts with human. The PTP pi/PTPRU Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PTP pi/PTPRU antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG |
|---|
| Other Names | FMI, hPTP-J, pancreatic carcinoma phosphatase 2, PCP2, PCP-2, pi R-PTP-Psi, protein tyrosine phosphatase J, protein tyrosine phosphatase, receptor type, U, protein-tyrosine phosphatase J, protein-tyrosine phosphatase pi, PTP, PTP pi, PTP-J, PTP-PI, PTPPSI, PTP-RO, Receptor protein tyrosine phosphatase hPTP-J, R-PTP-PSI |
|---|
| Gene, Accession # | PTPRU, Gene ID: 10076 |
|---|
| Catalog # | NBP1-81873 |
|---|
| Price | |
|---|
| Order / More Info | PTP pi/PTPRU Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|