| Edit |   |
|---|
| Antigenic Specificity | Neurexophilin 3 (NXPH3) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins. |
|---|
| Immunogen | Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT |
|---|
| Other Names | NPH3|Nph3 |
|---|
| Gene, Accession # | Gene ID: 11248 |
|---|
| Catalog # | ABIN633044 |
|---|
| Price | |
|---|
| Order / More Info | Neurexophilin 3 (NXPH3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|