| Edit |   |
|---|
| Antigenic Specificity | Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of MDH1B protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | MDH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV |
|---|
| Other Names | RP11-95H11|1700124B08Rik|AV255588 |
|---|
| Gene, Accession # | Gene ID: 130752 |
|---|
| Catalog # | ABIN631954 |
|---|
| Price | |
|---|
| Order / More Info | Malate Dehydrogenase 1B, NAD (Soluble) (MDH1B) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|