| Edit |   |
|---|
| Antigenic Specificity | KCNK4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KCNK4 antibody. Specificity: KCNK4 antibody was raised against the N terminal of KCNK4 |
|---|
| Immunogen | KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA |
|---|
| Other Names | KCNK4 protein, partial; Potassium channel subfamily K member 4; potassium channel subfamily K member 4; potassium channel, two pore domain subfamily K, member 4; TWIK-related arachidonic acid-stimulated potassium channel protein, KCNK4; KCNK4; TRAAK; K2p4.1; TRAAK1; TRAAK; Two pore K(+) channel KT4.1 |
|---|
| Gene, Accession # | KCNK4, Gene ID: 50801, NCBI: AAI31817.1 |
|---|
| Catalog # | MBS5300431 |
|---|
| Price | |
|---|
| Order / More Info | KCNK4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|