| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCNQ1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-KCNQ1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. |
|---|
| Other Names | potassium voltage-gated channel subfamily KQT member 1 isoform 1; Potassium voltage-gated channel subfamily KQT member 1; potassium voltage-gated channel subfamily KQT member 1; potassium voltage-gated channel subfamily Q member 1; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1, KCNQ1; KCNQ1; LQT; RWS; WRS; LQT1; SQT2; ATFB1; ATFB3; JLNS1; KCNA8; KCNA9; Kv1.9; Kv7.1; KVLQT1 |
|---|
| Gene, Accession # | KCNQ1, Gene ID: 3784, NCBI: NP_000209.2, UniProt: P51787 |
|---|
| Catalog # | MBS178601 |
|---|
| Price | |
|---|
| Order / More Info | KCNQ1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: KCNQ1 potassium voltage-gated channel, KQT-like subfamily, member 1. 2. Jespersen T, Grunnet M, Olesen SP (2005). The KCNQ1 potassium channel: from gene to physiological function. Physiology (Bethesda). 20 (6): 408-16. 3. Torekov SS, Iepsen E, Christiansen M, Linneberg A, Pedersen O, Holst JJ, Kanters JK, Hansen T (2014). KCNQ1 Long QT syndrome patients have hyperinsulinemia and symptomatic hypoglycemia.). Diabetes. 63 (4): 1315-25. |
|---|
| 产品资料 |
|
|