| 产品详情 |
| Edit |   |
| Antigenic Specificity | SH3BP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SH3BP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3BP2. This antibody reacts with human. The SH3BP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SH3BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY |
| Other Names | Abl-SH3 binding protein 2, Cherubism, CRBM, CRPM, FLJ42079, FLJ54978,3BP-2,3BP2, RES4-23, SH3 domain-binding protein 2, SH3-domain binding protein 2, TNFAIP3 interacting protein 2 |
| Gene, Accession # | SH3BP2, Gene ID: 6452 |
| Catalog # | NBP1-85458 |
| Price | |
| Order / More Info | SH3BP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|