| Edit |   |
| Antigenic Specificity | SH3BP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SH3BP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3BP4. This antibody reacts with human. The SH3BP4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SH3BP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LKVCMFSNMTNYEVKASEQAKVVRGFQLKLGKVSRLIFPITSQNPNELSDFTLRVQVKDDQEAILTQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIIL |
| Other Names | BOG25SH3 domain-binding protein 4, EHB10, EH-binding protein 10, SH3-domain binding protein 4, transferrin receptor trafficking protein, Transferrin receptor-trafficking protein, TTP |
| Gene, Accession # | SH3BP4, Gene ID: 23677, Accession: Q9P0V3, SwissProt: Q9P0V3 |
| Catalog # | NBP2-38352 |
| Price | |
| Order / More Info | SH3BP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |