| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-Catenin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, fish |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-Catenin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-Catenin. This antibody reacts with human, mouse, rat, fish. The beta-Catenin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of beta-Catenin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
|---|
| Other Names | beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923 |
|---|
| Gene, Accession # | CTNNB1, Gene ID: 1499, Accession: P35222, SwissProt: P35222 |
|---|
| Catalog # | NBP1-89989 |
|---|
| Price | |
|---|
| Order / More Info | beta-Catenin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25207459, 25502575 |
|---|
| 产品资料 |
|
|