| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-Catenin |
|---|
| Clone | CL3691 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-Paraffin HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-Catenin Antibody (CL3691) from Novus Biologicals is a mouse monoclonal antibody to beta-Catenin. This antibody reacts with human. The beta-Catenin Antibody (CL3691) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human beta-Catenin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH |
|---|
| Other Names | beta 1 (88kD), beta-catenin, catenin (cadherin-associated protein), beta 1, 88kDa, catenin beta-1, CTNNB, DKFZp686D02253, FLJ25606, FLJ37923 |
|---|
| Gene, Accession # | CTNNB1, Gene ID: 1499 |
|---|
| Catalog # | NBP2-61629 |
|---|
| Price | |
|---|
| Order / More Info | beta-Catenin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|