| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CYP24A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYP24A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP24A1. This antibody reacts with human. The CYP24A1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CYP24A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN |
|---|
| Other Names | 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial, CP241, CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase, Cytochrome P450 24A1, cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase, cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase), Cytochrome P450-CC24, EC 1.14.13.n4, exo-mitochondrial protein, MGC126273, MGC126274, P450-CC24, vitamin D 24-hydroxylase, Vitamin D(3) 24-hydroxylase |
|---|
| Gene, Accession # | CYP24A1, Gene ID: 1591 |
|---|
| Catalog # | NBP2-57213 |
|---|
| Price | |
|---|
| Order / More Info | CYP24A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|