| Edit |   |
| Antigenic Specificity | MIA2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MIA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIA2. This antibody reacts with human. The MIA2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of MIA2. Immunizing peptide sequence NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT. |
| Other Names | FLJ22404, melanoma inhibitory activity 2, melanoma inhibitory activity protein 2 |
| Gene, Accession # | MIA2, Gene ID: 117153, Accession: Q96PC5-2, SwissProt: Q96PC5-2 |
| Catalog # | NBP1-74078-20ul |
| Price | |
| Order / More Info | MIA2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |