| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MIA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIA3. This antibody reacts with human. The MIA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MIA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA |
|---|
| Other Names | ARNT, C219 Reactive Peptide, C219-Reactive Peptide, D320, KIAA0268, Melanoma Inhibitory Activity Family, Member 3, Melanoma Inhibitory Activity Protein 3, TANGO, TANGO1, Transport And Golgi Organization, Transport And Golgi Organization Protein 1, UNQ6077 |
|---|
| Gene, Accession # | MIA3, Gene ID: 375056, Accession: Q5JRA6, SwissProt: Q5JRA6 |
|---|
| Catalog # | NBP2-33770 |
|---|
| Price | |
|---|
| Order / More Info | MIA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|