| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAZ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAZ Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAZ. This antibody reacts with human. The MAZ Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MAZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEA |
|---|
| Other Names | MAZI, myc-associated zinc finger protein, MYC-associated zinc finger protein (purine-binding transcription factor), PUR1, Pur-1SAF-2, Purine-binding transcription factor, serum amyloid A activating factor 1, serum amyloid A activating factor 2, Transcription factor Zif87, ZF87SAF-1, Zif87, Zinc finger protein 801, zinc-finger protein, 87 kilodaltons, ZNF801SAF-3 |
|---|
| Gene, Accession # | MAZ, Gene ID: 4150 |
|---|
| Catalog # | NBP2-56933 |
|---|
| Price | |
|---|
| Order / More Info | MAZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|