| Edit |   |
| Antigenic Specificity | PPP1R3G |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPP1R3G Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R3G. This antibody reacts with human. The PPP1R3G Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPP1R3G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRY |
| Other Names | Protein Phosphatase 1 Regulatory Subunit 3G, Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 3G, Protein Phosphatase 1, Regulatory Subunit 3G, Putative Protein Phosphatase 1 Regulatory Inhibitor Subunit 3G |
| Gene, Accession # | PPP1R3G, Gene ID: 648791, Accession: B7ZBB8, SwissProt: B7ZBB8 |
| Catalog # | NBP2-34170 |
| Price | |
| Order / More Info | PPP1R3G Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |