产品详情 |
Edit |   |
Antigenic Specificity | CLASRP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The CLASRP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLASRP. This antibody reacts with human. The CLASRP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CLASRP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE |
Other Names | CLASP, Clk4 Associating SR-Related Protein, CLK4-Associating Serine/Arginine Rich Protein, SFRS16, Splicing Factor, Arginine/Serine-Rich 16, Splicing Factor, Arginine/Serine-Rich 16 (Suppressor-Of-White-Apricot Homolog, Drosophila), Suppressor Of White Apricot Homolog 2, Suppressor Of White-Apricot Homolog 2, SWAP2 |
Gene, Accession # | CLASRP, Gene ID: 11129 |
Catalog # | NBP2-32548 |
Price | |
Order / More Info | CLASRP Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|