| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | mitochondrial ribosomal protein L30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The mitochondrial ribosomal protein L30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to mitochondrial ribosomal protein L30. This antibody reacts with human. The mitochondrial ribosomal protein L30 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human mitochondrial ribosomal protein L30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTG ELVVQWHLKPVEQK |
|---|
| Other Names | 39S ribosomal protein L30, mitochondrial, L28mt, L30mt, mitochondrial ribosomal protein L30, MRP-L28FLJ44438, MRPL28MGC3314,39S ribosomal protein L28, mitochondrial, MRP-L30, RPML28MGC24095 |
|---|
| Gene, Accession # | MRPL30, Gene ID: 51263 |
|---|
| Catalog # | NBP2-13614 |
|---|
| Price | |
|---|
| Order / More Info | mitochondrial ribosomal protein L30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|