| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p23/PTGES3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p23/PTGES3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to p23/PTGES3. This antibody reacts with human, mouse, rat. The p23/PTGES3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat p23/PTGES3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDD |
|---|
| Other Names | cPGESp23, Cytosolic prostaglandin E2 synthase, Hsp90 co-chaperone, P23cytosolic prostaglandin E synthase, Progesterone receptor complex p23, prostaglandin E synthase 3, prostaglandin E synthase 3 (cytosolic), TEBPEC 5.3.99.3, Telomerase-binding protein p23, unactive progesterone receptor, 23 kD |
|---|
| Gene, Accession # | PTGES3, Gene ID: 10728 |
|---|
| Catalog # | NBP1-85486 |
|---|
| Price | |
|---|
| Order / More Info | p23/PTGES3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|