Edit |   |
Antigenic Specificity | ZSCAN5C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZSCAN5C Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZSCAN5C. This antibody reacts with human. The ZSCAN5C Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the C terminal of human LOC649137. Peptide sequence LKCHKRSHTGEKPFECKDCKKVFTYKANLKEHQRIHSGEKPHKCSKCPRA. |
Other Names | ZNF495C, ZSCAN5C zinc finger and SCAN domain containing 5C |
Gene, Accession # | LOC649137, Gene ID: 649137 |
Catalog # | NBP1-91389-20ul |
Price | |
Order / More Info | ZSCAN5C Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |