| Edit |   |
|---|
| Antigenic Specificity | ANKRA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRA2. This antibody reacts with human. The ANKRA2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human ANKRA2The immunogen for this antibody is ANKRA2 (NP_075526). Peptide Sequence: YAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESH |
|---|
| Other Names | ANKRARFXANK-like protein 2, ankyrin repeat family A protein 2, ankyrin repeat, family A (RFXANK-like), 2 |
|---|
| Gene, Accession # | ANKRA2, Gene ID: 57763, Accession: Q9H9E1, SwissProt: Q9H9E1 |
|---|
| Catalog # | NBP1-79395 |
|---|
| Price | |
|---|
| Order / More Info | ANKRA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|