| Edit |   |
| Antigenic Specificity | ANKRD54 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANKRD54 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD54. This antibody reacts with human. The ANKRD54 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ANKRD54 (ankyrin repeat domain 54) The peptide sequence was selected from the middle region of ANKRD54 (NP_620152). Peptide sequence EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND. |
| Other Names | ankyrin repeat domain 54, LIARankyrin repeat domain-containing protein 54 |
| Gene, Accession # | ANKRD54, Gene ID: 129138, Accession: Q6NXT1, SwissProt: Q6NXT1 |
| Catalog # | NBP1-57052 |
| Price | |
| Order / More Info | ANKRD54 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |