| Edit |   |
|---|
| Antigenic Specificity | PWWP Domain Containing 2A (PWWP2A) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown. |
|---|
| Immunogen | PWWP2 A antibody was raised using the C terminal of PWWP2 corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR |
|---|
| Other Names | MST101|4631424J17Rik|AI891583|AU024105|D930040F23Rik|RGD1305891 |
|---|
| Gene, Accession # | Gene ID: 114825,30306 |
|---|
| Catalog # | ABIN631539 |
|---|
| Price | |
|---|
| Order / More Info | PWWP Domain Containing 2A (PWWP2A) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|