| Edit |   |
|---|
| Antigenic Specificity | PWWP Domain Containing 2B (PWWP2B) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of PWWP2B protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | PWWP2 B antibody was raised using the N terminal of PWWP2 corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS |
|---|
| Other Names | PWWP2|RP11-273H7.1|bA432J24.1|pp8607|Pwwp2|AI594893|D7Ertd517e|D930023J19Rik|PWWP2B|MGC140452 |
|---|
| Gene, Accession # | Gene ID: 170394 |
|---|
| Catalog # | ABIN631542 |
|---|
| Price | |
|---|
| Order / More Info | PWWP Domain Containing 2B (PWWP2B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|