| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DEGS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DEGS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEGS1. This antibody reacts with human. The DEGS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DEGS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
|---|
| Other Names | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
|---|
| Gene, Accession # | DEGS1, Gene ID: 8560 |
|---|
| Catalog # | NBP2-57505 |
|---|
| Price | |
|---|
| Order / More Info | DEGS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|