| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DEGS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DEGS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DEGS1. This antibody reacts with human. The DEGS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to DEGS1(degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)) The peptide sequence was selected from the N terminal of DEGS1 (NP_003667). Peptide sequence GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIM |
|---|
| Other Names | Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1 |
|---|
| Gene, Accession # | DEGS1, Gene ID: 8560, Accession: O15121, SwissProt: O15121 |
|---|
| Catalog # | NBP1-59941 |
|---|
| Price | |
|---|
| Order / More Info | DEGS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|