| Edit |   |
| Antigenic Specificity | Essential Meiotic Endonuclease 1 Homolog 1 (S. Pombe) (EME1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EME1 interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. EME1 may be required in mitosis for the processing of stalled or collapsed replication forks.EME1 and MUS81 form an endonuclease complex that cleaves branched DNA structures, especially those arising during stalled DNA replication. |
| Immunogen | EME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR |
| Other Names | fc30c07|wu:fc30c07|EME1|6820428D13|MMS4L|SLX2A |
| Gene, Accession # | Gene ID: 146956,268465 |
| Catalog # | ABIN631739 |
| Price | |
| Order / More Info | Essential Meiotic Endonuclease 1 Homolog 1 (S. Pombe) (EME1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |