| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MiRP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MiRP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MiRP1. This antibody reacts with human. The MiRP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MiRP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE |
|---|
| Other Names | ATFB4, cardiac voltage-gated potassium channel accessory subunit 2, human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1, LQT5, LQT6, MGC138292, MinK-related peptide 1, minK-related peptide-1, MIRP1, Potassium channel subunit beta MiRP1, potassium channel subunit, MiRP1, potassium voltage-gated channel subfamily E member 2, potassium voltage-gated channel, Isk-related family, member 2, voltage-gated K+ channel subunit MIRP1 |
|---|
| Gene, Accession # | KCNE2, Gene ID: 9992, Accession: Q9Y6J6, SwissProt: Q9Y6J6 |
|---|
| Catalog # | NBP2-38146 |
|---|
| Price | |
|---|
| Order / More Info | MiRP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|