| Edit |   |
|---|
| Antigenic Specificity | Lin-7 Homolog C (C. Elegans) (LIN7C) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. |
|---|
| Immunogen | LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV |
|---|
| Other Names | LIN7C|fb75b09|wu:fb75b09|zgc:101881|LIN-7-C|LIN-7C|MALS-3|MALS3|VELI3|9130007B12Rik|AI303698|AU019331|AW125731|D2Ertd520e|Veli3 |
|---|
| Gene, Accession # | Gene ID: 55327,22343,60442 |
|---|
| Catalog # | ABIN630769 |
|---|
| Price | |
|---|
| Order / More Info | Lin-7 Homolog C (C. Elegans) (LIN7C) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|