| Edit |   |
| Antigenic Specificity | Lin-7 Homolog C (C. Elegans) (LIN7C) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. |
| Immunogen | LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV |
| Other Names | LIN7C|fb75b09|wu:fb75b09|zgc:101881|LIN-7-C|LIN-7C|MALS-3|MALS3|VELI3|9130007B12Rik|AI303698|AU019331|AW125731|D2Ertd520e|Veli3 |
| Gene, Accession # | Gene ID: 55327,22343,60442 |
| Catalog # | ABIN631151 |
| Price | |
| Order / More Info | Lin-7 Homolog C (C. Elegans) (LIN7C) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |