| Edit |   |
|---|
| Antigenic Specificity | Lin-37 Homolog (C. Elegans) (LIN37) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a protein expressed in the eye. |
|---|
| Immunogen | LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR |
|---|
| Other Names | F25965|ZK418.4|lin-37|1810054G18Rik |
|---|
| Gene, Accession # | Gene ID: 55957 |
|---|
| Catalog # | ABIN632413 |
|---|
| Price | |
|---|
| Order / More Info | Lin-37 Homolog (C. Elegans) (LIN37) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|