| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MIER1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIER1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIER1. This antibody reacts with human. The MIER1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MIER1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD |
|---|
| Other Names | DKFZp781G0451, Early response 1, ER1, hMI-ER1, KIAA1610MI-ER1, mesoderm induction early response 1 (MI-ER1), mesoderm induction early response 1 homolog (Xenopus laevis), mesoderm induction early response protein 1, MGC131940, MGC150640, MGC150641, Mi-er1 |
|---|
| Gene, Accession # | MIER1, Gene ID: 57708 |
|---|
| Catalog # | NBP2-55642 |
|---|
| Price | |
|---|
| Order / More Info | MIER1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|