| Edit |   |
| Antigenic Specificity | RNF170 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 91%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human RNF170 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETN |
| Other Names | ring finger protein 170, ADSA, DKFZP564A022, SNAX1 |
| Gene, Accession # | Gene ID: 81790, UniProt: Q96K19, ENSG00000120925 |
| Catalog # | HPA054621 |
| Price | |
| Order / More Info | RNF170 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |